PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100210880121
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family HB-other
Protein Properties Length: 957aa    MW: 106473 Da    PI: 8.5971
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100210880121genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox19.32e-0670126157
                                   TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                      Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                                   +++R  ++++ ++ ++ +F ++  +s++e +e++++ g+t +qV+ +F  +R++ +k
  Ote100210880121|100210880121  70 KKPRDLLNPKAVKYMQLVFSMKDAISKRETREISAQFGVTVTQVRDFFAGQRTRVRK 126
                                   7999*************************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.44267127IPR001356Homeobox domain
SMARTSM003890.008369131IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.9E-570134IPR009057Homeodomain-like
SuperFamilySSF466895.13E-670131IPR009057Homeodomain-like
CDDcd000860.0010270126No hitNo description
Gene3DG3DSA:1.20.930.103.7E-8256351IPR017923Transcription factor IIS, N-terminal
SuperFamilySSF476761.73E-7257349IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 957 aa     Download sequence    Send to blast
MELSKDTRLM ELAASPATTS YEQLLDKQKD LFQNQIEKLQ QIVATQCKLT GVNPLSQEMA  60
AGALSIKIGK KPRDLLNPKA VKYMQLVFSM KDAISKRETR EISAQFGVTV TQVRDFFAGQ  120
RTRVRKFVRL SREKSNATAC NVMHDPITSI SNSDMPTEPI PLETVAPIPL DTVAPIPLNA  180
VSPAPLDTIA PIPLDTVAPP STDEGPSCSK RHEDLSGLAD SDMHFVKNIF DSMRKEESFS  240
GQIKLMRWIL RITNPSVLNW FLSEGGLMIL ATWLSEAAKE EQTSYLLVIL KLLDYLPLSK  300
ALPGHMSAIL QSVNRLRFYR ASDISHRARP LLSKWSKMLG KNLSSKKSNT LKSASDLQDE  360
MLISEVMGNE SWDLKKENPE DALRLMCASP DSPRKLDNAQ PLKMLTASGD DSNKRRGVFP  420
PLTETRERRK VQLVEHPSEK SAVRSPQVAR STSATQSRPL SADDIQKAKM RAQFMQNKHG  480
KTVTPPDEKV KPESEKLKKL TTVNSLHASL ATPVSKSNVQ TEREEHRKVD GSLSTLSNPQ  540
EISSLNLEPP LKKVKRIPIP WQMPPELKID EAWSVGDGAH SKEVEVQKNR IRREREVVYR  600
TLQEVPSDPR EPWDREMDCD DSLTLEIPIE QLPDVEETLD ASSSNPNHSN GTVAASASME  660
SIPEPDFELL AELLKNPELV FALTSGQAGG NLSSDETVKL LDKIKANGVS SFSNLAGNGN  720
SNVEVSLPSP TPSSDPLPNG AKPDFSRNPF SRQHGGINST YQVQSQIPAT TIMAAQPSAT  780
LQHYAHNVVQ TPSQLPEQWQ QNPQMHHQSM PNYSNTHLNS EMVVLNGVAT STLPPSRSAT  840
PPNYLHEPPP VSSSSRSRHG FDSNNHPYQN NRSGNYHHAY AGGGAVAWGG RSSSANRSEY  900
DSWSPENSPS RHRDYYQNEA NVNTRNGYRH GKANQQNMVQ PLGYQDDRNK RWQDRRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011079715.10.0PREDICTED: homeobox protein LUMINIDEPENDENS
TrEMBLA0A022S4220.0A0A022S422_ERYGU; Uncharacterized protein
STRINGPOPTR_0002s20990.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52402123